Recombinant Human Phosphatidylinositol Transfer Protein a Isoform/PITPNA (N-6His)
497 EUR
50 ug
CE10-50
recombinants
Recombinants or rec. proteins
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Q00169
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 1mM EDTA, 1mM DTT, pH 8.0.
Dry Ice/ice packs
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Greater than 95% as determined by reducing SDS-PAGE.
34 kDa
MGSSHHHHHHSSGLVPRGSHMVLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGEKGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAVYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD
Escherichia coli
Human
Recombinant Human PITPNA is produced by our E.coli expression system and the target gene encoding Met1-Asp270 is expressed with a 6His tag at the N-terminus.